SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI41645 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI41645
Domain Number 1 Region: 3-173
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-20
Family APH phosphotransferases 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI41645
Sequence length 175
Comment (Postia placenta MAD 698)
Sequence
EGHTIEFVRKHTSIPVPCVFVAAEWCGRKYLLMKKVEGDNLEWAWQHLDAEQRSNIVLQL
RSFVLQLRALRSPHGPAVCGLNGVTCIDSRISSQPVGPFPNESAFNDGLIVAAKLHLCDE
ILADIRSRMRNDHRIALTHGDLAPRNIFVRGGTVVAVIDWEESGWYPEHWEFVKA
Download sequence
Identical sequences B8PN27
jgi|Pospl1|41645|gw1.310.18.1 XP_002477081.1.31404 104341.JGI41645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]