SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI48615 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI48615
Domain Number 1 Region: 164-400
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.71e-65
Family Tandem AAA-ATPase domain 0.0001
Further Details:      
 
Domain Number 2 Region: 337-556
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.06e-51
Family Tandem AAA-ATPase domain 0.0018
Further Details:      
 
Weak hits

Sequence:  104341.JGI48615
Domain Number - Region: 580-604
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00105
Family Retrovirus zinc finger-like domains 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI48615
Sequence length 618
Comment (Postia placenta MAD 698)
Sequence
MSEESAPKRRRVQRSPSPVYKLDNEDDSYEPYIPVTERRQAKLAKLTSWGVDKTKNQSPE
DEQDEREDEEREEERRREKARKERTLLMEAQEVHEKKAAEDSKKTDVEKAEEADAEILAA
IASRKKLASDLELAKGVSYTDSMKSSWRPPKFVRERSEEENTRIRDKYHILVDGEDIPAP
IENFTDMKVPAVLVKFLKSKRITTPTPIQLQGIPTAFSGRDMIGIAFTGSGKTLAFCLPM
MMFALEEESKLPFVRGEGPVGVILCPSRELATQTYENVVVWTNALARDGAYPQLNVLLCI
GGISMSDQSHVLNKGLHVVVATPGRLIDMLEKRRFTFDNCRYLCMDEADRMVDLGFEDDV
RNIMSYFKRQRQTLLFSATMPRKIQDFAQQSLVKPILVNVGRAGAANLDVLQVVEYVKQE
AKMVYLLECLQKTPPPVIIFSENKNEVDDIQEYLLLKGVEAVAIHGSKSQEERQYAIKSF
KSGAKDVMVASGVASKGLDFNDIQHVIIFSMPKEIEDYVHQIGRTGRSGKTGIATTFVNM
NTPEQTLLDLKYLLMEAGQKVPPFLQSIEDPRAAQGGSLKGCPVCGGLGHGISNCPKLED
TQRRQMASHRGSDDRGGY
Download sequence
Identical sequences 104341.JGI48615 jgi|Pospl1|48615|e_gw1.163.45.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]