SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI49116 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  104341.JGI49116
Domain Number - Region: 164-194
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00129
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 
Domain Number - Region: 94-171
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 0.0284
Family SP0239-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI49116
Sequence length 255
Comment (Postia placenta MAD 698)
Sequence
MRVPKRGVSGPSRAWRLSAAFAAAFKARFGNLDDEAAAQVELAKLCADKSVRKKRTAAEF
SALFKGLVDRSGYGDLELHDKYLSGIPSRVYRKIELETFTTWKEAEKRATKVEQILDISR
ARWPELNNFFSARGRGRGGARGGAPSTHAASASINAAVGKGDFPGTCFGCGKQGYRRFEC
PNCKDKPYTKCADTQATVALGSTQAATSAPVASSSASTSAASAKSESSELAGLIAQMKSM
RKELEHYRALKEESF
Download sequence
Identical sequences jgi|Pospl1|49116|e_gw1.256.1.1 104341.JGI49116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]