SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI51961 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  104341.JGI51961
Domain Number - Region: 129-154
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000523
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI51961
Sequence length 224
Comment (Postia placenta MAD 698)
Sequence
DDEAAAQVELVKLCADKSVREKRTAAEFSMLFKGPADRSGYGDLELCDKYLSGIPSCVYR
KIELETFTTWQDADKRATEVEQILDISRARRPELNNFFSARGRGRGGARGGAPSTHAASA
SINAAVGKGNFPGTCFGCGKQGYRRFECPNCKDKPYTKRADARATVASGSTQAATSAPIT
TTPSASISAASAKSEQSELADLMAQVKLMREELKHYRAMKEEGF
Download sequence
Identical sequences jgi|Pospl1|51961|e_gw1.242.3.1 104341.JGI51961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]