SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI52273 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI52273
Domain Number 1 Region: 306-376
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000125
Family RING finger domain, C3HC4 0.027
Further Details:      
 
Domain Number 2 Region: 198-233
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000209
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI52273
Sequence length 556
Comment (Postia placenta MAD 698)
Sequence
MTSSVFYKFKSQRDESRVTFDGTGISVFDLKKEVILANNMTKANDFDLVICDSSSGEEFK
DDSHVIPRSSSVLVKRVFVRPGKGKVAYYTGNTASPSGAPDSTSKNVGGVNSASSWHRGA
GNISKRFDVKSEREAPSQIFKVTPAPPTLTSSVTKDDEAAAMAAMFQAQTANWEETQEKM
SHAVRVHTNSRGGAGGRGRFHSHQPERPLPTSYVCYRCGQKGHWIQDCPTNNDREYDNRP
RIKRTTGIPRSFLKAVESPNGQIGQGVMVTPEGGYVVAQPDVASWQKQVTKHKGLTEADI
RERMPSDSSLVCPVDNKLFRDAVKTPCCGTLYCEECIQTHLLERDFICPNCGAKIASLDK
LIIDKPTRTKVGDYIDKEIERSHREGEEEASKSNGTPEPSGSNKVPFDQDYYSEQQPGEN
IDMSQIFAQSIPQIQAQISQIQIMLNNRSLPSQVRQQTQMKHQQLQMELQQAQMAAAMAA
TFQPGPAVGMPFNNMQGFQQPWSNPFPNQQPAGQDSAYQRLPLNNRRRNYLKRERPSDFL
EVGGSEHEAKMPRYWE
Download sequence
Identical sequences 104341.JGI52273 jgi|Pospl1|52273|e_gw1.135.14.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]