SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI53614 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI53614
Domain Number 1 Region: 469-589
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000255
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI53614
Sequence length 601
Comment (Postia placenta MAD 698)
Sequence
YYVPSTAWIPRYSWPLLGGDMLAGLTVACMLIPQSVSYATSLARLSPITGLFSASIPGII
YALFGTSRQLNVSPEASLSLLIGQAVDDFLHDPHFAHYGRDAVGLAVSTVVTFQVGLFSL
LLGLFRLGFIDVVLSRALLRGFVTAMAIVIMIEQLIPMFGLTALRGQYQLHTTLDKILFI
AENVWHHGHRLTMLIGFGSLAILLLIRSFKGFFKRYILIYRLPEVLLVVAVSTILCDKFD
WDERGVEILGSVPVTTGHSLVHFPLHKSTLRYFRRTTSLSVVCVIIGFLDSIVAAKQNAG
LYGYSISPNRELVALGAGNLAASFVPGTLPAFGSKIAGEVGARTQMASMICSIVVLLAVF
YILPWLYYLPKTVLGAVICLIVFSLLGEVPHDVKFYWKLRSWVDLGLMTLTFVLTIFWDL
ELGIAVSLVISLLLVVHRSSKTRMTILGRIPGTDTWKPVDENPEAQEDAAGVLIVRIREN
LDFANTAQLKERLRRLELYGVTKHHPSDEPRRESADVLVFHLADVDSIDASAAQIFYELV
DTYQSRGVGLYITHLKKGPRESFERAGIIKLLGEDAFCKDVASAMHLIEQAARDRREPSR
W
Download sequence
Identical sequences 104341.JGI53614 jgi|Pospl1|53614|e_gw1.7.151.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]