SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI58067 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  104341.JGI58067
Domain Number - Region: 218-239
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00942
Family Retrovirus zinc finger-like domains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI58067
Sequence length 308
Comment (Postia placenta MAD 698)
Sequence
MAKQSSIATGSCRSCTSTWLVNTLLTTIELKVQVALSLLDGDTRAWATSYFAQLASVQMG
VQGVTTPFRNEAAFTAAFKARFGNLDDAAAAQVELAKLCTDKLVREKCTAAEFSALFKGP
ADRSGYGDLELHNKYLSGIPSRVYRKIELETFTTWQAAEKRATEVEQILDISRARQPELN
NFFSARGRGRGGARGGASSTHAASASINAAIGKEDFPSTCFGCGKQGYRCFECPNCKDKP
YTKRADARAMVASGSTQAATSAPVASSSASTSAASAKSESSELVDLIAQMKSMREELEHY
LAMKEESF
Download sequence
Identical sequences 104341.JGI58067 jgi|Pospl1|58067|e_gw1.102.20.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]