SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI58151 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  104341.JGI58151
Domain Number - Region: 151-173
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000802
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 
Domain Number - Region: 77-158
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 0.0623
Family SP0239-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI58151
Sequence length 242
Comment (Postia placenta MAD 698)
Sequence
PLRNEAAFTAAFKARFGNLDDAAAAQVELAKLCADKSVREKRTAAEFSALFKGPADRSGY
GDLELRDKYLSGIPSRVYRKIELEIFTTWRAAEKRATEVEQILDISRARWPELNNFFSAQ
GRGHGGARGGAPTTHAASASINAAVGKGDFPGTCFGCGKQGYRRFECPNCKDKPYTKRAD
ARATVASGSTQAATSAPVASSSASTSAASAKSESSELADLIAQMKSMREELEHYRALKEE
SF
Download sequence
Identical sequences jgi|Pospl1|58151|e_gw1.125.19.1 104341.JGI58151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]