SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI59728 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI59728
Domain Number 1 Region: 26-70
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000000743
Family Retrovirus zinc finger-like domains 0.0022
Further Details:      
 
Domain Number 2 Region: 73-132
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000419
Family Retrovirus zinc finger-like domains 0.0029
Further Details:      
 
Domain Number 3 Region: 5-25
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000942
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI59728
Sequence length 132
Comment (Postia placenta MAD 698)
Sequence
MAYQFSRKGCFKCGNLGHIAENCTSEQRLCYNCRQPGHESSACPQPRTVAAKQCYSCGGV
GHIQAECPSLRVQGSNQKCYNCGRFGHIARVCPGGGAAGFATRAPPPGRALNTATLPPVK
CYRCGGPNHMAR
Download sequence
Identical sequences A0A1X6MSM9
jgi|Pospl1|59728|e_gw1.50.183.1 104341.JGI59728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]