SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI59948 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI59948
Domain Number 1 Region: 430-550
Classification Level Classification E-value
Superfamily HIT-like 0.000000000416
Family HIT (HINT, histidine triad) family of protein kinase-interacting proteins 0.012
Further Details:      
 
Domain Number 2 Region: 324-374
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000147
Family Retrovirus zinc finger-like domains 0.0054
Further Details:      
 
Weak hits

Sequence:  104341.JGI59948
Domain Number - Region: 10-121
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 0.00252
Family DNA double-strand break repair nuclease 0.097
Further Details:      
 
Domain Number - Region: 376-408
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0046
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI59948
Sequence length 660
Comment (Postia placenta MAD 698)
Sequence
LTVGSAAGSIRELFAKIKAIDAKHGKFDLVLCVGDFFGPPKDEGEAYSEDDEVIQLLEGK
LEVPVECYVMQGEHPLPAPVIEKFAKTGSFLTKGVSLFHKSGIITTPQSLRVACLGGIYD
SNLYAAAESAHGFTSPYFTSQTVEKLLSNSLTTSHPSDQNYTSLASIKATTSSSQLVDIL
ISNAWPSDITRFSSAPLPSPELSSIGVEPVAEVVRRTKPRYHFAAGGGIPPKFWEREPFI
WNEEGDRISRFVSVGAFGGQPTEGKKQRWFYAFSITPNSSTAPPPRPANATNNPLTEQAP
RAPKRPLIEDEGTNYRWGDPQGEPGKPPPGYKCKICESPEHFIMDCPDRAKPHEGYVCKI
CNESGHFVRDCPVKNAVGDTGGRKPKEGYVCRACGSELHYIQDCPVANQSGGGRHGGRGQ
RGPPKEIAPDECWFCLSNPNLAKHLIVSIGTECYVTLPKGQIVPTHTAADHPNAPAVPGG
GHVLIVPITHYPTYSSIPPDLAAPIVQETERYKAALQAMFAKHKAAFVAFEVGRLSAKGG
HAHVQIVPVPDKFKHSVEQAFLDEGQRLGIQFETDPDAALEACSGGRGSYFRVDLPDGRK
MVHLMRDSVPFSIQFGRWVLVSLLGMQDRFDWKACLQSEEEDKADVQAFKTAFAPFDPSL
Download sequence
Identical sequences jgi|Pospl1|59948|e_gw1.83.36.1 104341.JGI59948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]