SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI63152 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  104341.JGI63152
Domain Number - Region: 184-207
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00112
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI63152
Sequence length 276
Comment (Postia placenta MAD 698)
Sequence
VQVALSLLDGDACAWATPYFSQLASVQMGVQGATTPFRNEAAFTAALKARFGNLDDAAAA
QVELAKLCADKSVRKKCTAAEFSALFKGPADRSGYGDLELRDKYLSGIPSRVYRKIELET
FTTWQAAEKRATEVEQILDISRARWPELNNFFSARGRGRGGARGGAPSHGASASINAAVG
KGDFPGTCFGCGKQGYRRFECPNCKDKPYTKRADARATVASGSTQAATSAPVASSSASIS
AASAKSESSELADLIAQMKSMREELEHYRALKEESF
Download sequence
Identical sequences B8PG89
XP_002474695.1.31404 104341.JGI63152 jgi|Pospl1|63152|e_gw1.122.26.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]