SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI91165 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI91165
Domain Number 1 Region: 214-245
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000015
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI91165
Sequence length 289
Comment (Postia placenta MAD 698)
Sequence
MQSPINEQPLELPEVHDEAKIAFTVALMRKDLGKTWADTYYKKSAGGVQVYSTWADFVAA
LEEVFPEHGTRIKAHQILIKLPERQKDRKTALSLGNYVTRFEQLASKAQLKDAEVNGTNR
VENDYHTLHANFIKGLPKELYFALATRVARDRPNTMKAWYDEVRNADAAKQGALVVTDTR
DYGEPMDIDAAAVASTFASTLGGRKWELGAVLNEADQKLHRDGNLCFYCHIKGHSAKDCR
KKAAARQGGGRPNQGGSGKDDFCARIKTLSADKKRELLALPCPGPRVQN
Download sequence
Identical sequences B8P1Q6
jgi|Pospl1|91165|fgenesh3_pg.8__167 XP_002469619.1.31404 104341.JGI91165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]