SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI91410 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  104341.JGI91410
Domain Number - Region: 292-338
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00215
Family Retrovirus zinc finger-like domains 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI91410
Sequence length 351
Comment (Postia placenta MAD 698)
Sequence
MFNPVRLARRITSTKYASYTATCARSSQRSEAFSHMKPAADQEESKAKIDGGTTSAKSGA
AFLGFAYDLPRVEPRDRDVEPQRAVPLEPSQPQQATPSELPQPQQATAPEPSQPRQATLL
ELSQLQQAAPLEPLLSFNLPPLPELPDKPKYPCPYLTDAEITTYLVPLYKRGWTVQSSNK
AARQGHPSVAPALVKRFIFLKERGYANLQFTEDIERFQKDEDVSGVPHPPKVRPGITLRD
VRLAILAERAFEAHLVRGKGDPRAMRADTRPAMCPLTMQDVEERRLSYDAIRHRQGCPVC
GSKKHLKGECPKQYEVKPRRLCVHCGEMHWDFQCPQEKKELESDAGPSSAI
Download sequence
Identical sequences B8NZD7
jgi|Pospl1|91410|fgenesh3_pg.1__155 XP_002468752.1.31404 104341.JGI91410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]