SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI91640 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  104341.JGI91640
Domain Number - Region: 183-227
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0015
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI91640
Sequence length 385
Comment (Postia placenta MAD 698)
Sequence
MSSTLPFLDQFNAPSTEGGKRTSIYTPKHTHVGDNTLLTLLLSNPTNVFNKLKAHNSKAT
NATDRAALEAYLSARREYDEAVKAADEAIDHHKRLLRQQDNRVLTELIRLDNLKVAHRFQ
PLLLRSIQARHNKFIPRAIPNVYLPLPAHLPTSAFKHPPIPSPFLQATPRSTTIPADWQP
NPGWTPKGSCRQCRLSQHWVRDCLDVQCVGCGKEAPGHLERECGTRPMKRHVSAPPEEPA
RRVGVVINNVFLEGIINEAKERKEKERQTKVVPIPPPRSANPEPLASPVAGPLRPRPDTP
VIFRKVDPDWTPDTTQWTWDSSWPRQEHLSGEEWKNVGRNARKEWFDEEEDDGVDWELYG
DGEHLHNGVHVHFIPGIVPLRFFLY
Download sequence
Identical sequences A0A1X6MQQ0 B8P4C2
XP_002470534.1.31404 jgi|Pospl1|91640|fgenesh3_pg.20__84 104341.JGI91640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]