SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI92183 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI92183
Domain Number 1 Region: 265-297
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000523
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI92183
Sequence length 338
Comment (Postia placenta MAD 698)
Sequence
MATFTQEDINQRIAVALAAYQSQQSTANRPLCLDIPAPEPFSGKAEDLRRFIQCVLSYFV
TTNNTQLSDEAKIAFTVALMRKDLGKTWADMYYEKSAGGVQVYSTWANFVAALEEAFPEH
GTRIKAHQILMKLPERQRDRKTALSLGNYVTHFEQLASKAQLKDTEVNGTNRVENDYHTL
HANFVKGLPKELYFALATRVARDRPNTMKAWYDEVRNTNTAKQGALVITDTRDYGEPMDI
DTAAVASTFTSTLGGRKWELGAVLNEADRKLHRDGNLCFYCHIKGHSAKDCRKKAAARQG
GGRPNQGGSGKDDFRARIKTLSADEKRELYKELTMEDF
Download sequence
Identical sequences B8PK14
XP_002476021.1.31404 jgi|Pospl1|92183|fgenesh3_pg.184__17 104341.JGI92183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]