SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI92478 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI92478
Domain Number 1 Region: 255-284
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000576
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI92478
Sequence length 287
Comment (Postia placenta MAD 698)
Sequence
MATFTQEDIDQRIAVALAAYQSQQSTANRPLHLDIPALEPFSGKAEDLRCFIQCVLSYFV
ATNNTRLSDEAKITFTTWADTYYEKSAGGVQVYSTWANFVAALEEVFPEHGTRIKAHQIL
MKLPERQRDRKTALSLGNYVTRFEQLASKAQLKDAEVNGTNRVENDYHTLHANFVKGLPK
ELYFALATRVARDRPNTMKAWYDKVRNTDAAKQGALVVTDTRDYGEPMDIDAAGVASTFA
STSGGRKWELGAVLNKADRKLHRDGNLCFYCHIKGHSAKDCRKKVAA
Download sequence
Identical sequences B8PET5
XP_002474201.1.31404 jgi|Pospl1|92478|fgenesh3_pg.105__20 104341.JGI92478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]