SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI92733 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI92733
Domain Number 1 Region: 759-790
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000256
Family Retrovirus zinc finger-like domains 0.0029
Further Details:      
 
Domain Number 2 Region: 1393-1476
Classification Level Classification E-value
Superfamily Acid proteases 0.0000436
Family Retroviral protease (retropepsin) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI92733
Sequence length 1521
Comment (Postia placenta MAD 698)
Sequence
MPLPRVLLVEDPITPEPLSMLLSMEACLAAVCLWIDDVDGDVDIHAAGSAIAAANTIAPI
QSADLIDDAGYSAIFAEGKCIILDKDGVTIGSIPKTHGLYLVAHLHNGGSVHAVATQPDR
LSIMDLHRHLSHIALRAIHELLSKGLVTGFELIPSDKPKRHGCPPAAQLPSSGTAALQPS
LLHQRLAVYNDKDGNGTSTAGASGMLGHWMFPPLAPFAHAHDVPPGYAPLGYAPSGYTPP
GYAPPGYAPHPQPTLLHAPWYAPHGWPVDSQTLDSYEVMDLRDAGHYYCPLPPQFCMPEF
HTPSLMMPDSTYIPSGRVHPHFYEDFGQAAATAFTDVPQAYIMGSVHTSYLVSCHYVSFF
TKHDHTDTMSNISSTITSNNAVNPVPLGLPALAGSPLLQYDQADRCFVTSTKRAPIYPRG
GTWCRATGPNPQVIAHQELVSYYQRHPPAHPEDVFTILRIDVEPTQTAESVQSPINEQPL
ELPEVQYVPIEIPDIELPPAPPAPTNAPVEVPMATFTQEDINQRIAVALAAYQSQQSTAN
RPLRLDIPAPEPFSGKAEDLRHFIQCILSYFVTTNNTRLSDEAKITFTVALMRKDLGKTW
ADAYYKKSAGGVQVYSTWADFVAALEEAFPEHRMKTVLSLGNYVTRFEQLASKAQLKDAE
VNGTNRVENDYHTLHANFVKGLPKELYFALATRVARDRPNTMKAWYDEVRNADAAKQGAL
IVTDTRDYGEPMDIDAAAIASTFASTSGGRKWELGAALNEANRKLHRDRNLCFYCHIKGH
SAKDCQKKAAARQGGGRPNQGGSGKDDFRARIKALSADEKRELPAPTTTTNMSQTTNTPL
MPPRGHSTAPSFDPSEVRSLRHYFQDLEALFTRCQITDEAAKKQWAVRYPSIDVADLWET
IESFIDVTKSYNDWKADVRALYPGADDTRKWSLADMDQLIGEHARIGIHNAADLGCYYRD
FMAITKHLIAQHRLSTIEQSRAFLRGFQPALLTRLETRLHLKHPDHYADDPYTMAEIHAA
ATFILHGTSSTPTTAANQATASTSNASTTVPPGMIKTEDISMIIESLSRTIATLIQPTTH
ATHNHAPAPRQQAAGHVHENTGAEQTCHYCGNRGCRVGTCEFAEIDIRDGKCKWNTDGKI
VLPNGSFCPRTIPGLTIRDRIYEWHRRNPAAPAAPTMLFEIDDRSTDRGARTRTPSASEV
KGGLHGVEILQRKKPTTTAIPRSAEASGSVHPFANARDATYAPPNVRNFATPPKPSNDKG
KEPAYKTIVPVIQPKLAEEIFQRSMKSQFVTLTPEELLSIAPDVRNKYRDAVTPKRVSTE
PIASAHIVEIGADEVTAVNQLSCSGATLEPGATIVPDPYETYLKHIPHGEHPAEFTVARD
SNAIRSIIALIDNKEQIECIVDPGSQIVAMSEEVCLGLNLLFDPTIQLNMQSANGEVDRS
LGLIRNVPFRIGEIVLYLQAHVIRNTAYDILLGRPFDVLTQSVVKNFADENQTITILCPN
TGETEDREAGSILPGVANRIF
Download sequence
Identical sequences B8PA74
jgi|Pospl1|92733|fgenesh3_pg.60__59 104341.JGI92733 XP_002472600.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]