SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI92754 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI92754
Domain Number 1 Region: 360-389
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000139
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI92754
Sequence length 478
Comment (Postia placenta MAD 698)
Sequence
MQSTGFLWDYQPSQDHHSSSMTEQTAASSPPQKGLPSTLEAAPGVVQLRHPPAHPEDVFT
TLRIDVEPTQTTESVQSPINEQPLELPEVQYVPIEIPDIELPPAPPAPTNAPVEVPMATF
TQANIDQRIAVTLAAYQSQQSTANRPLRLNIPAPEPFSGKAEDLRCFIQCILSYFVTTNN
TRLSDEAKIAFTVALMRKDLGKTWADVYYEKSAGGVQVYSTWADFVAALEEAFPEHGTRI
KAHQILMKLPERQKDRKTVLSLGNYVTRFEQLASKAQLKDTEVNGTNRVKNNYHTLHANF
VKGLPKELYFALATRVARDRPNTMKAWDYGEPMDIDAAAVASTFASTSGGRKWKLGAVLN
EADRKLHRDGNLCFYCHIKGHSAKDCHKNVAARQGGGRPNQGGSGKDNFRARIKTLSADE
KRELRIPHGTSTQSPNTSTSPSTLFDTFDGARRLLETRHGRPDASRVDPGTSSAFGEQ
Download sequence
Identical sequences B8PA89
jgi|Pospl1|92754|fgenesh3_pg.60__80 XP_002472630.1.31404 104341.JGI92754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]