SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI92768 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI92768
Domain Number 1 Region: 609-700
Classification Level Classification E-value
Superfamily Acid proteases 0.000000413
Family Retroviral protease (retropepsin) 0.076
Further Details:      
 
Domain Number 2 Region: 273-309
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000144
Family Retrovirus zinc finger-like domains 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI92768
Sequence length 1902
Comment (Postia placenta MAD 698)
Sequence
MATTGVAALPIAGTKSAPKKFTEKLASLLKVYLHTMLYFLTGIVKSLGAWREYTRGFLTI
SGWLRRNQRITTDEEALYFWKGIPRLFRQLLEPRLLTAQPNHDLSKPFVMSDVNSKAEAL
LQRNRFDTDRLPSDDEDSDDESSASESDSDSNDSSDSESEHDKKKRKQKAAKHKVRTKKR
LVVKSEDSDNEEDIKKAQATRKKATKEMKKKANEVDDLVRQLNRMSLEDPDYGVTYLRAC
RLDPLVASVVRKPLIESTPPMTRPSAPMTSALRGNAQTGTSRAEMKCYGCGKLGHGLSSC
PDILGLIDQGIIIRDGITGRLTMKDGSRIFRGMDEPFTTAIEHQVGPQSHFITAAEAPFC
AKVEEAASEESDGDGDDEDEDEDSNTEAVYVMPVKPTEKIIRTAWKQAAQGPVVPPVRIQ
EKVDRAKGDKQKDKPPHMNESVERRLARIQGQPAPAISDPKPDREVRPVQPHTTRDSHER
VWEHQQPVDTSQRNFDPANDDEIMEDDFEPITQKQKLAKDAKKGNKTDATPGKEDGTKRV
PKKSDVQAQVDQMKILGKVLSTPVTLAVGEVFGISKEMSQHLQNVLKPKSPVVNIVASSF
STKTRGLLIRLRIEIDGRPIIAIVDTGSQLNIAHKRIWKTMLNRPMDIARSVNMNDANGG
AGILQGLVENVPLTCGGVLTHANLYIGDKVPFDLLLGRPWQRGNYISIDERSDGTYLLFK
DKDLEVRHEILVTPDGLDPNWSFDPAVWHSIQNSTQKGLLGQKDTRVLYCGDFREDYIYN
SAYEKFWQRLGADLDEMEQQEQEEQTTSRESIQPANDYTVYQVQQQPTPTLLWEDKLLND
RLYVHDHSHLNEEPLLICGIKIPESGGDQIASPNSESATYEEPLQQLEIQKQKRKNLEAN
NWCAPGLVGTAFPETLDGGVPEDQYEMFRSNKEHTPVRTNEKCTHQVVRPLGLAPVCCGQ
EKQVVSCLRTPAEGARDPNAQLEESDRGVLGIGNEEYLTLASRSGYEPVSSDSNEVDEDA
WQHTNVQAARPGNAGELRRNGDQYEPISQEDKSVPFIVSKELMQLEARLFALAPVHRSQK
GATWIGREECYTPESERLIAAPPGMLSPLLRKDGSVKQLASTQAENEGDAENLPGDPSRE
RTPARANRWPWCACPGSVKTLSCTTHCSDTPQPVRASSASCAESNNAQTQTQTRQLFRNE
IGSYLPKFSLMLRPQRAARTPPLAQIKTANKELKRLVMQRGRNSPDPQLVKQRMVNWLAH
QRTGNLEHAAACSLTCHRDSPEVGNVGHREPIEGIAQEESRGRDQPRKEARVGTKEKGEG
RARKRDRSANVVAERKVRRREAPIRVVHSIEICSEDLDTPDFALRALPDLRQASVPLASS
SRLSRMLSLQVSSPEHPYHDSHDARRAPQQENARTRHNSASRQDAYPAECQNADARSRML
TTPPEIFKTLPTGLKSPSVKPAMPVLHQSTPYPSAMPPTQCYRLTSGAVGTVRFVPPTGP
PPPTMRQSTGIQGDQLVLLGHHDLNVHGPANLGRLALGGNFTVRCAPQQTHLGTQQTFVV
LGCVVWYTEPGESEACPYFGDAVITFTFRGPTETIVPFVHAYEPPPPPPPSAAIQTMSTT
RNERPILPLPRRAPVPQERAQQECASHDIADVWLVENAAILGNILAASPSDIPAMLNARP
LVPPPLSSSGLPSPSTPLLPVTTPDGCDIENLKIPGLLYPQDSTDADVRAVSPLKTNGLR
AEPVQDEDEDMPSLDFLAMQAKRRTTSALYWSPSEPSEMQRVNTLRPSMSDFEDFGYLEK
AANLAMDSTPMCCLIELENGETSEDVNAPLPWFFSSELEEDDEEIYAFTDFNVLGVYKRF
LVYFLKMHEWNVDSQKTHCYHYQNCHLTRLTLYPERDLPETV
Download sequence
Identical sequences A0A1X6MLU4 B8PCP0
jgi|Pospl1|92768|fgenesh3_pg.82__12 104341.JGI92768 XP_002473458.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]