SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI93205 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI93205
Domain Number 1 Region: 183-227
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000272
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI93205
Sequence length 364
Comment (Postia placenta MAD 698)
Sequence
MSSTLPFLDQFNAPSTEGGKRISIYTPKHTHVSDSALLMLLLSNPTDVFNKLKTHNPEAT
NATDRTALEVYLSAHHEYDEAVKAADEAIDHHKRLLRQQDDRVLTELIRLDNLKVAHRFQ
PLLPRSIRAQHNKFIPRVIPNAYLPLPAPLPTSAFRRPPIPSPFLQATPRSTTIPADWQP
NPGWTPKGSCRRCGSSRHWVRDCPDVRCAGCGKEAPGHLERECGTRPMKRHVSAPPEEPA
RRVGVVVDNVFLKEIINEAKERKEKERQTKAVPIPPPRSANPEPPTSPIAGPSRPRPDTP
VVFRKVDPDWTPDTTQWTWDSFWPHQKHLSGEEWMNVGRDTRKEWFDEEEDDGVDWELYG
DGEQ
Download sequence
Identical sequences B8P2J2
jgi|Pospl1|93205|fgenesh3_pg.11__132 104341.JGI93205 XP_002469862.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]