SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI93630 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI93630
Domain Number 1 Region: 502-531
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000299
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 
Weak hits

Sequence:  104341.JGI93630
Domain Number - Region: 591-635
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000149
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI93630
Sequence length 935
Comment (Postia placenta MAD 698)
Sequence
MDGVIFGSRVSGHPKRMFARVIVIHQYTSTDLGPILSANTPICAHSLHTRKAKANTIKPK
SLSTNITCRPLQNCDKSTNYVRKSKGYYLRQTSNISSTITSNNAVNPVPLGLPALAGSPL
LQYDRADHCFVTSTKRAPIYPRGSTWCRATGPNPQVVAHQELVSYYQRHPPTHPEDIFTI
LRIDVEPTQTAESVQSPTSEQPLELPEVQYVPIEIPDIELPPAPPAPTNAPVEVPMATFT
QADIDQRIAVALAAYQSQQSTANRPLRLDIPAPEPFSGKVEDLRRFIQCILSYFVATNNT
RLSDEAKIAFTVALMRKDLGKTWADAYYEKSAGGVQVYSTWADFVAALEEVFPEHGTRIK
AHQILMKLPERQKDRKTALSLGNYVTRFEQLASKAQLKDTEVNGTNRIENNYHTLHANFV
KGLPKELYFALATRVARDRPNTMKAWYDEVRNTDAAKQGALVITDTRDYGEPMDIDATAV
ASTFASTSGGRKWELGAVLNEADWKFHRDGNLCFYCHIKGHSAKDCRKKAAARQGGGRPN
HGGSGKDDFRARIKTLSADEKRELRLPIPSPFLQATPRSTTIPADWQPNPGWTPKGSCRR
CGSSRHWVRDCPDVQCAGCGKEAPGHLERECGTRPMKRHVSAPPEEPARHVGVVVDNVFL
EGIINEAKERKERQTKAIPIPPPRSANPEPPTSPVAGPSRPRPDTPVVFRKVDPDWTPDT
TQWTWDSSWPNQKHLSGEEWMNVGRNARKEWFDEKEDDGVDWELYGDAHLSMDYRPDVGH
GDGSWTRREGVRIDAEIEGVPSAEKQGPHVVRNELASSGARVAGGRRPPIVVYNDCVRCF
INEVRVTLDLMTFGQSFRVHGLRERCEQDIRAMGSGDGAGDEYRSAMFKHVRIWSNIRVF
GRMRAGIMTWRNWGRREPGLTESRGDWRRPGFANS
Download sequence
Identical sequences B8PIL1
104341.JGI93630 XP_002475512.1.31404 jgi|Pospl1|93630|fgenesh3_pg.157__12

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]