SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI94194 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI94194
Domain Number 1 Region: 408-438
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000169
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 
Domain Number 2 Region: 662-706
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000051
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI94194
Sequence length 852
Comment (Postia placenta MAD 698)
Sequence
MSNISSTITSNNAVNPVPLGLPALAGSPLLQYDRADRCFVTTTRRTPIYPRGGSWVRAEG
SNPQIVAHQQLVSYYQRHPPAHPEDVFATLRINVEPAQTTENLQSPVNEQPFELPDVQYV
PIEAPELPPAPPTPTNAPVEVPMATFTQADIDQRIAVALAAYQSQQSTANRPLRLDIPAS
EPFSGKAEDLRRFIQCVLSYFVATNNTRLSDEAKIAFTVALMRKDLGKTWADAYYEKSAG
GVQVYPDWAAFATALEEAFPEHGTRIKAHQILMKLPERQKNKKTALSLGNYVTRFEQLAS
KAQLKDAEVNGVNCTENDYHTLHANFVKGVPKELYVSLATRVARDRPSTMKAWYDEVRNA
DAAKQGALTVTDTRDYGEPMDIDAAAVAATFASTSGGRKWELGAVLNEADRKLHRDGNLC
FYCHIKGHSAKDCRKKAAARQGGGKPNQGGSGKDDFRARIKALSADEKRELCYIPTRTNM
SSTLSFLDQFNAPSTEGGKRLSIYTPKHTHVGDSTLLTLLLSNPTDVFNKLKSHNPEATN
ATDRAALEAYLSARREYDEAVKAADEAIDHHKRLLRQQDDRVLTELIRLDNLKVAHRFQP
LLPRSIRARHNKFIPRAIPNAYLPLPAPLPMSAFRRPPIPSPFLQATPRSTTIPADWQPN
PGWTPKGSCRRCGSSRHWVRDCPDVRCAGCGKEAPGHLERECGTRPMKRHVSAPPEEPAR
HVGVVIDNVFLEGIINEAKERKQKERQTKAVPIPPPRSANPEPPASPVAGPSRPRPDTPV
VFCKTWDSSWLNQKHLSGKEWMNVGRNMRKEWFDEEEDNGVDWELYGDGEHLHNGVCAHF
VPGIVPLRFFLH
Download sequence
Identical sequences B8PLT0
XP_002476634.1.31404 jgi|Pospl1|94194|fgenesh3_pg.234__3 104341.JGI94194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]