SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI95438 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI95438
Domain Number 1 Region: 183-227
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000471
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI95438
Sequence length 333
Comment (Postia placenta MAD 698)
Sequence
MSSTLSFLDQFNAPSTEGGKRLSIYTPKHTHVGDSTLLTLLLSNPTDVFNKLKAHNPEAT
NATDRAALEAYLSARREYDEAVKAADEAIDHHKRLLRQQDDRVLTELIRLDNLKVAHRFQ
PLLPRSIRARHNKFIPRAIPNAYLPLPAPLPTSAFRRPPIPSPFLQAMPRSTTIPADWQP
NPGWTPKGSCRRCGSSRHWVRDCPDVRCAGCRKEAPGHLERECGTRPMKRHVSAPPEEPA
RRVGVVINNVFLEGIINEAKERKEKERQTKAIPIPPPRSANPEPPTSPVAGPSRPRPDTP
IVFCKVDPDWTPDTTQWTWDSSWPNQKHLSGEE
Download sequence
Identical sequences A0A1X6MHK4 B8PME1
104341.JGI95438 jgi|Pospl1|95438|fgenesh3_pg.261__10 XP_002476846.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]