SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI95550 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI95550
Domain Number 1 Region: 267-297
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000012
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI95550
Sequence length 828
Comment (Postia placenta MAD 698)
Sequence
MATFTQADIDQRIAVALAAYQSQQSTANRPLRLDIPAPEPFSGSPAEDLRRFIQCILSYF
VATNNTRLSDEAKIAFTVALMRKDLGKTWADAYYEKSAGGVQVYPDWAAFATALEEAFPE
HGTRIKAHQILMKLPERQKNKKTALSLGNYVTRFEQLASKAQLKDAEVNGVNRTENDYHT
LHANFVKGLPKELYVSLATRVARDRPNTMKAWYDEVRNADAAEQGALTVTDTRDYGEPMD
IDAAAVAATFASTSGGRKWELGAVLNEADRKLHRDGNLCFYCHIKGHSVKNCRKKAAARQ
GGGRPNQGGSGKDDFRARIKTLSADEKRELRYIPTRTNMSSTLPFLDQFNAPSTEGGKRI
SIYTPKHTHVGDSTLLTLLLSNPTDVFNKLKAHNPEATNATDRAALEAYLSARREYDEAV
KAADEAIDHHKRLLRQQDDRVLTELIRLDNLKVAHRFQPLLPRSIRARHNKFIPRAIPNA
TSVNVALIRQRPPVHVHCFNSSHIHRHQIAKVDKAVEAPLIVGGIMRSRRRRQSGDDGLC
KGELVVGRVPVPNDLTHQLQERLHAIRKTGGKSSGALDEPEDHHLDGRETFELCHELPDM
HVFSVRCVRPKLEFWWGDKATVDQADDYLLQRYIGEDTIPRTDHALVLFHIRDRIADTDN
ICNGRAGDLPHTITRLRKCKVFLESIPDDAIKDCVRLRGRVNTTLARAEARGRGWTCAAN
TGIGFASRHFDRRAIDDNKVAKGGERRRREDDDEVEAVAAKRARGNSSASRWSKSEERPP
KMEGGTRSSGTSVGSNPEVWQLLQRGGSAEEANGQDELDDDDSNADGT
Download sequence
Identical sequences B8P9R9
104341.JGI95550 XP_002472410.1.31404 jgi|Pospl1|95550|fgenesh3_pg.56__68

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]