SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI95964 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI95964
Domain Number 1 Region: 1225-1256
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000227
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 
Domain Number 2 Region: 407-438
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000262
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 
Weak hits

Sequence:  104341.JGI95964
Domain Number - Region: 662-706
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000102
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI95964
Sequence length 1340
Comment (Postia placenta MAD 698)
Sequence
MSNNSSTITSNNAVNPVPLGLPALAGSPLLQYDRADRCFVTTTRRIPIYPRGGSWVRAEG
SNPQIVAHQQLVSYYQRHPPAHPEDVFAILRINVEPAQTTENLQSPVNEQPFELPDVQYV
PIEAPELPPAPPAPTNTPVEVPMATVTQADIDQRIAVALAAYQSQQSTANRPLRLDIPAP
EPFSGKAEDLRRFIQCILSYFVATNNTRLSDEAKIAFTVALMRKDLGKTWADAYYEKSAG
GVQVYPDWAAFATALEEAFPEHGTRIKAHQILMKLPERQKNKKTALSLGNYVTRFEQLAS
KAQLKDAEVNGVNRTENDYHTLHANFVKGLPKELYVSLATRVARDRPNTMKAWYDEVRNA
DAAEQGALTVTDTRDYGEPMDIDAAAVAATFASTSGGRKWELGTVLNEADRKLHRDGNLC
FYCHIKGHSAKDCRKKAAARQGGERPNQGGSGKDDFRTRIKTLSADEKRELRYIPTRTNM
SSTLSFLDQFNAPSTEGGKRLSIYTPKHTHVGDSTLLTLLLSNPTDVFNKLKAHNPEATN
ATDRAALEAYLSARREYDEAVKAADEAIDHHKRLLRQQDDRVLTELIRLDNLKVAHRFQP
LLPHSIRARHNKFIPRAIPNAYLPLPAPLPTSAFRRPPIPSPFLQATPRSTTIPADWQPN
PGWTPKGSCRRCGSSRHWVRDCPDVRCAGCGKEAPGHLERECGTRPMKRHVSAPPEEPVR
RVGVVVDNVFLEEIINEAKERKEKERQTKAVPIPPPHSANPEPPTSPVAGPSRPRPDTPV
VFRKVDPDWTPDTTQWTWDSSWPNQKHLSGEEWMNVGRNARKEWFDKEEDDGVDWELYGD
VNPVPLGLPALAGSPLLQYDRADRCFVTTTRRIPIYPRGGSWVRAEGSNPQIVAHQQLVS
YYQRHPPAHPEDVFAILRINVEPAQTTENLQSPVNEQPFELPDVQYVPIEAPELPPAPPA
PTNAPVEVPMATFTQADIDQRIAVALAAYQSQQSTANRPLRLVIPAPEPFSRKAEDLRHF
IQCILSYFVATNNTRLSDEAKIAFTVALMRKDLGKTWADAYYKKSAGGVQVYSTWADFVA
ALEEAFPEHGTRIKAHQILMKLPERQKDRKTALSLGNYVTRFEQLASKAQLKDAEVNGTN
RVENDYHTLHANFVKGLPKELYFALATRAWYDEVRNADAAKQGALIIADTRDYGEPMDID
AAAVASTFASTSGGRKWELGAVLNEADRKLHRDGNLCFYCHIKGHSAKDCRKKTAARQGG
GRLNQGGSGKDDFRARIKTLSANEKRELTGGQGAPGCCLIYMRENPPGTGNGPLVPSLND
VMVQTESGFYLEKVRHQSLA
Download sequence
Identical sequences B8P902
104341.JGI95964 XP_002472184.1.31404 jgi|Pospl1|95964|fgenesh3_pg.51__7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]