SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI95988 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI95988
Domain Number 1 Region: 407-439
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000924
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI95988
Sequence length 525
Comment (Postia placenta MAD 698)
Sequence
MSNNSSTITSNNAVNPVPLGLPALAGSPLLQYDRADRCFVTTTRRTPIYPRGSSWVRAEG
SNPQIVAHQQLVSYYQRHPPAHPEDVFATLQINVEPAQTTENLQSPVNEQPFELPDVQYV
PIEAPELPPAPPAPTNAPVEVPMATFTQADIDQCIAVALAAYQSQQSTANRPLRLDIPAP
EPFSGKAEDLRCFIQCILSYFVATNNTRLSDEAKIAFTVALMRKDLGKTWADVYYEKSAG
GVQVYSTWADFVAALEEAFPEHGTRIKAHQILMKLPKRQKDRKMALSLGNYVTRFEQLAS
KAQLKDTEVNGTNRVENDYHTLHANFVKGLLKELYFALATRVARDRPNTMKAWYDEVRNA
DTAKQGALVVTDTRDYGKPMDIDAAAVASTFASTLGGRKWELGAVLNKADRKLHRDGNLC
FYCHIKGHSAKDCRKKVAARQGGGRPNQGGSGKDDFRARIKALSADEKRELRIPPGTSTQ
SPNTSISPLTLFDIFDGARRLLEARHGRPDASRVDPGTSSAFGEQ
Download sequence
Identical sequences B8P914
XP_002472160.1.31404 jgi|Pospl1|95988|fgenesh3_pg.51__31 104341.JGI95988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]