SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI96316 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI96316
Domain Number 1 Region: 16-60
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000108
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI96316
Sequence length 251
Comment (Postia placenta MAD 698)
Sequence
MPRSTTIPADWQPNPGWTPKGSCRRCGSSRHWVRDCPDVRCAGCGKEAPGHLERECGTRP
MKRHVSAPPEEPARRMGVVINNVFLEGIINEAKERKERERQTKAIPIPPPRSANPEPPAS
PVAGPSRPRPDTPVVFRKVDPDWTPDSTQWTWDSSWPHQKHLSGEEWMNVGRNACKEWFD
EEEDDGVDWELYGDGEQPSDPQHIANMYRLTVYTHVAYPGICWSDPSSSKMLTHTCQNVR
KFKLQSRKQEI
Download sequence
Identical sequences B8PKT0
XP_002476285.1.31404 jgi|Pospl1|96316|fgenesh3_pg.202__23 104341.JGI96316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]