SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI96490 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI96490
Domain Number 1 Region: 267-297
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000148
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 
Weak hits

Sequence:  104341.JGI96490
Domain Number - Region: 51-142
Classification Level Classification E-value
Superfamily Caspase-like 0.0785
Family Caspase catalytic domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI96490
Sequence length 383
Comment (Postia placenta MAD 698)
Sequence
MATFAQADIDQRIAVTLAAYQSQQSTANRPLHLDIPAPEPFSGKAEDLRRFIQCILSYFV
ATNNTQLSNEAKIAFTVALMRKDLGKTWADAYYEKSAGGVQVYSTWADFVAALEEVFPEH
GTRIKAHQILMKLPERQKDRKTALSLGNYVTRFEQLASKAQLKDAEVNGTNRVENDYHTL
HANFVKGLPKELYFALATRVARDRPNTMKAWYDEVRNADAAKQGALVVTDTRDYGEPMDI
DATAVASTFASTSGGRKWELGAALNEADWKLHRDGNLCFYCHIKGHSAKDCRKKAATRQG
GGRPNQGGSGKDDFRARIKTLSADEKRELRIPPGTSTQSPNTSISPSTLFDIFDGARRLL
EARHGHPDASRVDLGTSPAFGGQ
Download sequence
Identical sequences B8P0Q6
XP_002469225.1.31404 jgi|Pospl1|96490|fgenesh3_pg.5__137 104341.JGI96490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]