SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI96591 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI96591
Domain Number 1 Region: 348-377
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000366
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI96591
Sequence length 380
Comment (Postia placenta MAD 698)
Sequence
MHSTRFLWDYQPSQDHRSSSTTKQIAASSPPQKGLSSTFEVAPGVMQPVQTCRSSPIKNS
LATTRDTHPLIQKMYSPSYGSTLNLHKQQKVCSHPSTNNHSNSPKFTPPAPTNTLVEVPM
AMFTQEDIDQRIAVTLAAYQSQQSTANQPLHLDIPAPEPFSGKAEDLRRFIQCILSYFVA
TNNTQLSDEAKIAFTVVLMRKDLGKTWADAYYEKLAGGVQKDRKMALSLGNYVTRFEQLA
SKAQLQDTEVNGTNCVKNDYHTLHANFVKELPKELYFALATRVTRDRPNTMKAWYDEVRN
ADTAKQGALIITDTRDYGEPMDIDAAAVASTFASTSGGRKWELGAVLNKADRKLHRDRNL
CFHCHIKGHSAKDCRKKAAA
Download sequence
Identical sequences B8PBY8
104341.JGI96591 XP_002473202.1.31404 jgi|Pospl1|96591|fgenesh3_pg.74__37

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]