SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI96674 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI96674
Domain Number 1 Region: 384-416
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000366
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 
Weak hits

Sequence:  104341.JGI96674
Domain Number - Region: 24-82
Classification Level Classification E-value
Superfamily Serum albumin-like 0.0294
Family Serum albumin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI96674
Sequence length 457
Comment (Postia placenta MAD 698)
Sequence
MEGGRGVNLVPLGLPALAESPLIQYDRADCCFITSTKRAPIYPRGGTWCRATGPNPQVVA
HQELVSYYQRHPPAHPEDVFTILRIDVEPTQTTESVQSPINEQPLELPEVQYVPIEIPDI
KLPPAPPASTNAPVEVPMATFTQADIDQRIAVALAAYQSQQSTANRPLHLDIPAPEPFSG
KAEDLRRFIQCILSYFVATNNTRLSDEAKIAFTVALMRKDLGKTWADAYYEKSAGGVQVY
STWANFVAALEEVFPEHRTKTALSLSNYVTRFKQLASKAQLKDAEVNGTNRVENDYHTLH
ANFVKGLPKELYFALATRVARDRPNTMKAWYDEVRNTDAAKQGALVITDTRDYGKPMDID
AAAVASTFASTSGGRKWELGAVLNEADRKLHRDGNLCFYCHIKGHSTKDCRKKAAARQGG
GRPNQGGSGKDDFRARIKALSADEKRELYEELTMEDL
Download sequence
Identical sequences B8P539
jgi|Pospl1|96674|fgenesh3_pg.25__44 104341.JGI96674 XP_002470777.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]