SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI97819 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI97819
Domain Number 1 Region: 375-402
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000227
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI97819
Sequence length 405
Comment (Postia placenta MAD 698)
Sequence
MSNISSTITSNNAVNPVPLGLPALAGSLLLQYDRADHCFVTSTKRAPIYPRGGTWCHATG
PNPQVIAHQELVSYYQRHPPAHPEDVFTTLRIDVEPTQTTESVQSPINEQPLELPEVQYI
PIEIPDIELPPAPPAPTNAPVEVPMATFTQADIDQRIAVALAAYQSQQSTANRPLRLDIP
APEPFSGKAEDLRRFIQCILSYFVATNNTRLSDEAKIAFTVALMRKDLGKTWAGAYYKKS
AGGVQRDRKTALSLGNYVTRFEQLASKAQLKDTEVNGTNRVENDYHTLHANFVKGLLKEL
YFALATRVARDRPNTMKAWYDEVRNADAAKQGALAVTDTRDYGEPMDIDAAAVASTFAST
SGGKKWELGAVLNEADWKLHRDGNLCFYCHIKGHSAKDCRKKAAA
Download sequence
Identical sequences B8PG56
104341.JGI97819 XP_002474666.1.31404 jgi|Pospl1|97819|fgenesh3_pg.121__37

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]