SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI97996 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI97996
Domain Number 1 Region: 266-296
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000103
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI97996
Sequence length 558
Comment (Postia placenta MAD 698)
Sequence
MATFTQADIDQCIAVALAAYQSQQSTANRPLRLDIPAPEPFSGKAEDLRRFIQCVLSYFV
ATNNTRLSDEAKIAFTVALMRKDLGKTWADAYYEKSAGGVQVYPDWATFATALEEAFPEH
GTRIKAHQILMRLPERQKNKKTALSLGNYVTRFEQLASKAQLKDAEVNGVNRTENDYHTL
HANFVKGLPKELYVSLATRAARDRPSTMKAWYDEVRNADAAEQGALTVTDTRDYGEPMDI
DAAAVAATFAPTSGGRKWELGAVLNEADRKLHRDGNLCFYCHIKGHSAKDCRKKAAARQG
GGKPNQGGSGKDDFRARIKALSADEKRELSYHFWSPPRGDFRQEFAAFGFPKTSPVVTRS
QAREAASRSAAENLDSSSRTHSTPSPTTPGDFDRDEEDEIDQELQDDFDEEPIPSTAEEH
TSSPELLGLTTSDYDFSTPDLFERSSSSPEPADPIPATSNLVLPTPSSFRVHAQPPIASS
SRLSIIPPSDLAPPPPLAPLNTASNSNSTPPAPTIPSTITTSSSSPAPTTTTNMSQNTNA
PLMPPRGHSTAPTFDPSE
Download sequence
Identical sequences B8PK86
XP_002476095.1.31404 104341.JGI97996 jgi|Pospl1|97996|fgenesh3_pg.189__1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]