SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI98011 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI98011
Domain Number 1 Region: 536-646
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.96e-22
Family Cap-Gly domain 0.00078
Further Details:      
 
Weak hits

Sequence:  104341.JGI98011
Domain Number - Region: 967-1018
Classification Level Classification E-value
Superfamily Resolvase-like 0.00128
Family gamma,delta resolvase, catalytic domain 0.0075
Further Details:      
 
Domain Number - Region: 1247-1268
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00712
Family Retrovirus zinc finger-like domains 0.0068
Further Details:      
 
Domain Number - Region: 1047-1121
Classification Level Classification E-value
Superfamily YhbY-like 0.0392
Family YhbY-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI98011
Sequence length 1271
Comment (Postia placenta MAD 698)
Sequence
MAPPPPTIIHCSSLADYEYQMTSLRDPILIPETEETWDRIANAMIRMTALVRGNAADYPL
ETVANVRPVSRPLNSAASSERTRLSGVAIELLTCLNGFNPPDLEREPRAREIEGTIRLTA
TDASADVRKIAKKIFEAYKQLLPRRVESFTQPLTPTVKKYLNIKASAAPSSNSNPPSRPP
SSQSLNLVQERPPKQQFSSSTSAIRSNSGTFPTRRPTQPPHRLGGKVKSDMAPPVFIPKR
PDSAATTTSNHEHDDDVLFKSEPRVAASVPGSSSTMPERPRTISQSQPQRPPSSTGTLNA
RGPMRQPIPQEPPRGVRSGPIRPGTMGAPGGQPTERKERVASEKLKTVIVLLNEKPKPAP
PQPSEKPKPVPSRTKSSVTAGTKSSNAKTASGSADQKSSAHAKTVKSKGDAKVAKAAVAS
VESRPSRQTHARARSKTPALVPVQVPLPPSPGPGDAPALVPLPPSPDLRELEIPALVPLP
PSPPPSPPIPPAPVVEIPRPVTPKRTLGHLAPLAVEQTPISALVADIQRGFLFTPFTPFT
PAPRAGRSFEEGDNVRIESLGYEGTLKYLGEIDGKPGHWAGVELSGGFAGKGKNNGAVNG
KQYFVCPPNCGSSRPSSVASSRNGRITPSFSLSGRITPSASTSTSTGRKTPSFSNGRATP
SLPNGRVTPSAGRKTPGGPVPATRARSVTGNARAAVDAITPVRPAAAQNIITPGSRASNR
TSGIGVGVPPGSPSRRNTPRARVPSGIAMPPPASPSIKSGRSISVTMSDQGFSHRGANSL
TDLESNGKALQDKIAQLMAGRVPRPGSSASGGSSGHSEELQQEIERLHARLTAAEDENRR
LRESTDAQNGAVQRAEKLAAEQKQSATRITELESTVRANERLLNERETAIEAVERAAKEK
EADIEKIKSDADARLRDIQSKLDDKEALVDNLKELIEAKEGLQTENDAVLQAKNAEITLL
EARVQKAYAELEDERQELGAQVEELRKAGQETIALYEERLSAADTQRYELEDLIASLDEQ
LRAKLEPLSPVTAQRQATSAVEIDNESLREQAQHLQKRIAVLEDQLEEAHATFDREEAAD
LKVLEENIEQSILREEALESSDGSVPTSAAGDVAVLHKKYEVYAIASVLCLTKRSIYRED
ELERELERLREKVARSQKKSSKLSTEPPAAPPDERPVGSGAKKISTEPVSAGTQEVCEIC
ERPGHDIFTCDLLKDDVAPMPMSAPAMSTSMSMSSMSSMSMGGDADEELFCEDCEGRGHT
AENCPHSLDVF
Download sequence
Identical sequences B8PNS9
104341.JGI98011 jgi|Pospl1|98011|fgenesh3_pg.480__1 XP_002477334.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]