SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI98150 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI98150
Domain Number 1 Region: 226-253
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000645
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI98150
Sequence length 256
Comment (Postia placenta MAD 698)
Sequence
MAMFTQADLDQKAEDLRHFIQCVLSYFVTTNNTALSDEAKIAFTVALMRKDLGKMWVDVY
YEKSAGGTQVYSTWAGFVDTLEQAFPEHGTRLKAHQKDKKTALSLGDYITHFEQLAQKAQ
LKDTEVNGTTHVKNNYHTLHTNFIRGLPNELYLSLTTRVARDRPKTMKDWYDKIRNTNTV
KKGALLITDTRDYGKPMDIDAATIASTFTSTLGGRKWELGAVLNEADWKLHRDGNLCFYC
HIKGHSAKDCHKKAAA
Download sequence
Identical sequences B8PMU8
104341.JGI98150 jgi|Pospl1|98150|fgenesh3_pg.287__8 XP_002477004.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]