SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI98192 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  104341.JGI98192
Domain Number - Region: 346-377
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00011
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI98192
Sequence length 419
Comment (Postia placenta MAD 698)
Sequence
MTEQTAASSPPQKGLPSTLEAAPGVVQPVQTRRSSLIKNSLATTRDTHPLTQKTYSPSYG
STLNLYKQQKACSHPSMNNHSNFLKFTPPAPTNTPVEIPMASFTQEDINQRIAVALAAYQ
SQQSTANRPLRLDIPAPEPFSGKAEDLRRFIQCVLSYFVATNNTRLSDEAKIAFIVVLMR
KDLGKTWADTYYKKSAGGIQVYSTWANFVAALEEVFPEHGTKTALSLSNYITCFEQLASK
AQLKDAEVNGTNRVENDYHTLHANFVKGLPKELYFALATRVARDRPNTMKAWYDEVRNTD
AAKQGALVVTDTRDYGEPMDIDTAAVASTFASTSVGRKWELGAVLNEANRKLHRDGNMCF
YCHIKGHSTKDCHKKAATRQGGGRPNQGGSGKDDFCARIKTLSADKKRELYEELTMEDF
Download sequence
Identical sequences B8P165
104341.JGI98192 jgi|Pospl1|98192|fgenesh3_pg.7__33 XP_002469407.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]