SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI98193 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI98193
Domain Number 1 Region: 183-227
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000314
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI98193
Sequence length 432
Comment (Postia placenta MAD 698)
Sequence
MSSTLPFLDQFNAPSTEGGKRISIYTPKHTHVGNSTLLMLLLSNPTDIFNKLKTHHPEAT
NATDRAALEAYLSARREYNKAVKAADEAIDHHKRLLCQQDDRVLTELIRLDNLKVAHRFQ
PLLPCSIQARHNKFILRTIPNTYLPLPAPLPTSAFRRPPIPSPFLQAMPRSTTIPADWQP
NPGWTPKGSCRRCGSSRHWVQDCPDIRCTRCGKEAPGHLERECGTRPMKRHVSAPPEEPA
RRVGVVVDNVFLEGIINEAKERKERERQTKAVPIPPLCSANPEPQASPIAGSSRPRPNTP
VVFHKVDPNWTPNTTPWTWDSSWLRQEHLSGEEWKNVGRNARNKWFDEEEDDGVDWELYG
DGEQRQAPLGPDTALFGSRIPHGTSTHSPNTSISPSTLFDIFDGARSLLEARHGRPDASR
VDLGTSPAFGGQ
Download sequence
Identical sequences B8P166
XP_002469408.1.31404 104341.JGI98193 jgi|Pospl1|98193|fgenesh3_pg.7__34

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]