SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI98194 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI98194
Domain Number 1 Region: 298-333
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000916
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI98194
Sequence length 344
Comment (Postia placenta MAD 698)
Sequence
MYSLVFGTYILVHCLLAPFVLASMYDQGFDGQWGAGAGDAPAPPEAPTEPQPQVNQPQTQ
LPSAEAQCIHALLEAVVAIGAGQQAFMDNQTRYGLALEVLTRHLDNTTLGSLQSNSQPRS
RGVKTRDPRMFNGRSTEVVSFLCEICAYIDLQQDPNLVKSSLTAIENLKQTGAAADYANK
FQEHLVHLDLSMFTQITYFDRGLKPSLKLVLVNTPRPATLDGWIATIVEADNRLHEYERE
QKSLTKAAGKQPAPRNDRHASPVVTTQMTMQMVAPAAASSHSNVVPMEIDAMCRGPITAE
EKERRHKNGLCFYCGQGKHLARDCPNMSKQAKKKVKASPAQGKA
Download sequence
Identical sequences B8P167
104341.JGI98194 jgi|Pospl1|98194|fgenesh3_pg.7__35 XP_002469472.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]