SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI98359 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI98359
Domain Number 1 Region: 6-206
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.38e-21
Family Protein kinases, catalytic subunit 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI98359
Sequence length 225
Comment (Postia placenta MAD 698)
Sequence
MNNPRAYPQEALATEYVRQHTSIPVPRVLDVVPFWCDEVYILMTKLPGEQLGLRAGDIKD
LSPRRLQILEDALRGWFEQLRALEPPDPDAVCGFGGSGIKCYRISHDNYVGPFASQNDFH
QLLLGACAATYGPMTAASHSKTHRIWFTHGDITPHNILLDEDMKPVGLVDWECAGWMPEY
WDYTYALYIRYPRYMAWCDLFTRIFPQYGVELEAEYKLWEIANPW
Download sequence
Identical sequences B8P1G1
104341.JGI98359 jgi|Pospl1|98359|fgenesh3_pg.7__200 XP_002469451.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]