SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI98572 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI98572
Domain Number 1 Region: 385-416
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000014
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 
Weak hits

Sequence:  104341.JGI98572
Domain Number - Region: 170-261
Classification Level Classification E-value
Superfamily Caspase-like 0.00121
Family Caspase catalytic domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI98572
Sequence length 489
Comment (Postia placenta MAD 698)
Sequence
MQSTQFLWDYQPSQDHRSSSTTEQIAALSPPQKELPSTLEAAPGVVQPVQTRRSSPIKNS
LATTRDTHPLTQKTYSPPYGSTSNLHKQQKACSHPSTNNHSNSLKFTPPAPTNTPVEVPM
ATFTQADIDQRIAVALAAYQTQQSTANRPLRLDIPAPEPFSGKAEDLRCFIQCILSYFVA
TNNTRLSDKAKIAFTVALMRKDLGKTWVDAYYEKSAGGVQVYSTWADFVAALEEVFPEHG
TQIKAHQILMKLPERQKDRKTALSLGNYITRFEQLASKAQLKDAEVNGTNRVENDYHTLH
ANFVKGLLKELYFALATRVARDRPNTMKAWYDEVRNADAAKQGALIVTDTRDYGEPMDID
AAAVASTFASTSGERKWELGAVLNEADRKLHRDRNLCFYCHIKGHSAKDCRKKAAARQGG
GRPNQGGSGKDNFRARIKTLSADEKRELSISPSTLFDTFDDARRSLEARHGRPDASRVDP
GTSPAFGEQ
Download sequence
Identical sequences A0A1X6N0X9 B8P9C9
104341.JGI98572 jgi|Pospl1|98572|fgenesh3_pg.53__73 XP_002472269.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]