SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI98717 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  104341.JGI98717
Domain Number - Region: 620-664
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0115
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 
Domain Number - Region: 365-396
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0178
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI98717
Sequence length 832
Comment (Postia placenta MAD 698)
Sequence
MVRAYTTEQTVASSPPQEGLPSILEAAPGYYQKHPPTHPEDVFTTLRINFEPAQTTENLQ
SPVNEQPFKLPDIQYVPIEAPDTEPPPASSAPTNALVEPPMTTFTQADINQRIAAALDTH
RLQQSTANRPLRLDIPTPEPFSGKAEDLRCFLQCVLFYFVATNNTRLNDEAKIAFTIALM
RKDLGKTWADAYYMKLAEGVQVYPDWAAFATALEEAFPEHGTRIKAHQILMKLPERQKNK
KTVLSLGNYITCFEQLASKAQLKDTEVNGINRTENDYHTLHANFIKGLPKELYVSLTTRV
ARDRPNTMKAWYDEVRNANAAEQGALTVTDTRDYGKPMDINTAAVAATFASTWGGRKWEL
GAVLNEADRKLHRDGNLCFYCHIKSHSTKDCHKKAAARQGGGRPNQGGSRKDNFHARIKA
LSADEKRELRYIPTRTNMSSTLSFLDQFNAPLTKGGKRLSIYTPKHTHVGDSTLLTLLLS
NPTDVFNMLKAHNPKATNATDRAALEAYLSARREYDEAVKAADKAIDHYKRLLCQQDNCV
LTKLIRLDNLKVAYRFQPLLPCNIRAQHNKFIPRAIPNAYLPLPTPLPTSAFRQPPIPSP
FLQATPRSTTIPADWQPNPGWTPKGSCRQCGSSRHWVWDCLDVRCAGCRKEAPGHLEQEC
ETRPMKRHISAPPEEPAQRVRVAVDNVFLEGIINEVKERKEKERQTKAVLIPPPCSTNPQ
PPTRPVAGPLRPRPDTPVVFRKVDPDWTPNTTQWTWDSSWPNQKHLSGEEWTNVGRNACK
EWFDEEEDDGVDWELYGDGKQLCTLVRAQLVCAQHADAATGAVDSDTSISGR
Download sequence
Identical sequences B8PLY9
jgi|Pospl1|98717|fgenesh3_pg.239__1 104341.JGI98717 XP_002476694.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]