SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI98768 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI98768
Domain Number 1 Region: 282-308
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000366
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 
Weak hits

Sequence:  104341.JGI98768
Domain Number - Region: 68-172
Classification Level Classification E-value
Superfamily Caspase-like 0.0593
Family Caspase catalytic domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI98768
Sequence length 308
Comment (Postia placenta MAD 698)
Sequence
GSNPQIVAHQQLVSYYQRHPPAHPEDVFATLRINVEPAEITENLQSPVNEQSFELPDVHG
KAEDLRRFLQCVLSYFVATNNTRLSDEAKIAFTVALMRKDLGKTWADAYYEKSAGGVQVY
PDWAAFATALEEVFPEHGTRIKLHQILMKLPERQKNKKTALSLGNYITRFEQLASKAQLK
DAEVNGINRTENDYHTLHANFVKGLPKELYVSLATRVARDRPNTMKAWYDEVRNTDAAKQ
GALVITDTRDYGEPMDIDAAAITSTFASTLGGRKWELGAVLNEADRKLHRDGNLCFYCHI
KGHSAKDC
Download sequence
Identical sequences B8PP43
jgi|Pospl1|98768|fgenesh3_pg.592__1 XP_002477448.1.31404 104341.JGI98768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]