SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI98935 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI98935
Domain Number 1 Region: 183-226
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000164
Family Retrovirus zinc finger-like domains 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI98935
Sequence length 387
Comment (Postia placenta MAD 698)
Sequence
MSSTLLFLDQFNAPSTEGGKRISIYTPKHTHVGDSALLTLLLSNPTDVFNKLKTHNPEAT
NATDRATLEAYLSARHEYNEAVKAANEVIDHHKRLLRQQDDRVLTELIRLDNLKVAHRFQ
PLLPRSIWTRHNKFIPCAIPNAYLPLPAPLPTSAFRRPPIPSPFLQATPRSTTIPADWQP
NPGWTPKGSCRRCGSSQHWVRDCPDVRCTGCGKEAPGHLERECGTRLMKRHVSAPPEEPA
RRMGVVVDNVFLEGIINEAKERKERERQTKAVPIPPPRSANPEPLASPVAGPSCPRPDTP
IVFRKVDPDWTPDTTQWTWDSSWPRQEHLSGEEWKNLGRNARNEWFDEEEDDGVDWELYG
DAYIMGSVRTSYSASYHYVSFFTNTST
Download sequence
Identical sequences A0A1X6MTH9 B8PI54
XP_002475368.1.31404 jgi|Pospl1|98935|fgenesh3_pg.150__7 104341.JGI98935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]