SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI99084 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI99084
Domain Number 1 Region: 297-335
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000121
Family Retrovirus zinc finger-like domains 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI99084
Sequence length 346
Comment (Postia placenta MAD 698)
Sequence
MAQQGLDQGFDGSWGDAGIQQPPQPAPPEAGVNPADAADRILFQAVAALGRHQDAFANNQ
QLQSAALESLARSIDELRQRVSATPAPSTSAGPRNIKVRDPRTFNGKSSEVVPFLREKQK
TTLFSMYLKDGSPIQWFNTIEAKRSELLYDWEELQRIFTTRFQDSDLVSTSLRKLEALKQ
TGSAATYANLFEEYLTYVDVSDYMQITYFDRNLKPRLKEILVNEKRPATLDEWIPTVITA
DNRLHELERETRELKSKPSGHRHSELAQATPRVASTPAPAASSSTVVPMEIDAVRRGPVM
AEEKERRRRLGLCFYCGQGKHTIQDCPNMSDKAKKARAKAVPSGKA
Download sequence
Identical sequences B8P6P3
104341.JGI99084 jgi|Pospl1|99084|fgenesh3_pg.34__90 XP_002471321.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]