SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI99445 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI99445
Domain Number 1 Region: 585-614
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000164
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 
Weak hits

Sequence:  104341.JGI99445
Domain Number - Region: 210-233
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00342
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI99445
Sequence length 617
Comment (Postia placenta MAD 698)
Sequence
MSSPTAIPDKETLKLLLPLRYDGKSVVECNRFISQLLIYWTINTALSSLELKIQVALSLL
DGDARAWATPIFSQLASVQMGIQGATTPFVDEKAFLQAFKARFGNLDDAAAAQVELAKLC
SDKTMREKRTAAEFSALFKGPVDRSGYGNLELRDKYLSGIPSRVYRKLKLETFATFFSAR
GRGRGGARGGAPSSHAASASINMAVGKGNFPGTCFGCGKQGYRRFECPNCGSWVRAEGSN
PQIVAHQQLVSYYQRHPPAHPEDVFATLRINVEPAQTTENLQSPVNEQPFEFPDVQYIPI
EAPELPPAPPTPTNAPVEVPMATFTQADIDQRIAVALAAYQSQQSTANRPLRLDIPAPEP
FSGKAEDLRRFIQCVLSYFVATNNTRLSDEAKIAFTVALMRKDLGKTWADAYYEKSAGGV
QVYPDWAAFATALEEAFPEHGTRIKAHQILMKLPERQKNKKTALSLGNYVTRFEQLASKA
QLKDAEVNGVNRTENDYHTLHANFVKELPKELYVSLATRVARDRPSTMKAWYDEVRNADA
AEQGALTVTDTRDYGEPMDIDAAAVAATFASTSGGRKWELGAVLNEADRKLHRDGNLCFY
CHIKGHSAKDCRKKAAA
Download sequence
Identical sequences B8PAC6
104341.JGI99445 jgi|Pospl1|99445|fgenesh3_pg.61__1 XP_002472631.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]