SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI99591 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI99591
Domain Number 1 Region: 183-227
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000272
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI99591
Sequence length 364
Comment (Postia placenta MAD 698)
Sequence
MSSTLPFLDQFNAPSTEGGKRISIYTPKHTHVGDSALLMLLLSNPTDVFNKLKTHNPEAT
NATDCAALEAYLSARHEYDEAVKAADEAIDHHKRLLRQQDDRVLTELIRLDNLKVAHRFQ
PLLPRSIRAQHNKFIPRAIPNAYLPLPAPLPTSALRRPPIPSPFLQAMPRSTTIPADWQP
NPGWTPKGSCRRCGSSRHWVRDCPDVRCAGCGKEAPGHLERECGTRPMKRHVSAPPEEPA
RRVGVVVDNVFLEGIINEAKERKEREKQTKAVPIPPPRSANPEPPASPVAGPSRPRPNTP
VIFRKIDPNWTPDTTQWTWDSSWPRQKHLSGEEWKNLGRNARNEWFDEEEDDGVDWELYG
DGEQ
Download sequence
Identical sequences B8PND2
jgi|Pospl1|99591|fgenesh3_pg.359__1 104341.JGI99591 XP_002477188.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]