SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI99705 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI99705
Domain Number 1 Region: 259-283
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000145
Family Retrovirus zinc finger-like domains 0.0044
Further Details:      
 
Weak hits

Sequence:  104341.JGI99705
Domain Number - Region: 454-508
Classification Level Classification E-value
Superfamily Acid proteases 0.0113
Family Retroviral protease (retropepsin) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI99705
Sequence length 594
Comment (Postia placenta MAD 698)
Sequence
MSMPLDNGSPIKMDTLSWLGQPPYYMPSGKATAGITTGAPDTCSARTRQQKGITDDKDIV
TTVTRYTSLKVKDLIKTLESYKIPSWKDLRADLLQYYNTDQSTQQYTLSDLMMFQVWSAK
QPIRSLDKWHRYTQKFQHVTGWLLEHSMITENGMHMKLHAHIIINLKVNDPKHNYCTPFS
VDKVTTAVETYLQRNHFDAEHLLSDQETADSLDDSSNEDDSSSSEDDVVHKPVMMGATVT
VMTMPVPVMDVHTAMGSINRGCFGCGNPGHGVRDCPEVLQLLSDGIVTRDMSGQIIMKDG
GHVACMSAVEGLITHSRTAAPSQEAPPVWDPPPHEPLLTQPIEVLPLRVTVDPNNSDAFM
EDDTHNLDEITTKPRVSADSLKGLEATGKRVPRRIELQAQIDQADILDRVLGTSVSLKIG
KVLAISKDMSHQLQNVLKLRQAAMVALTVVTPSRGTLIKLQMECDDRPVTAIIDTGSQLN
IAHWRVWKSMLRRPMDVTCFVNMNDVNGGWDSTYLLFKDHNLNVRHKILVTPGRHDQGWH
FDPDAFSAKLTHSPAATASTYYLQTEGEDISLKPGGQTGVAALTDLSSVIEEVT
Download sequence
Identical sequences A0A1X6N2A5 B8P9I6
jgi|Pospl1|99705|fgenesh3_pg.55__3 XP_002472341.1.31404 104341.JGI99705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]