SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 106370.Francci3_0425 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  106370.Francci3_0425
Domain Number 1 Region: 463-568
Classification Level Classification E-value
Superfamily SpoIIaa-like 8.24e-16
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 106370.Francci3_0425
Sequence length 582
Comment (Frankia CcI3)
Sequence
MTTGQAEDPRPHCPAPIRTAPSRWPRPLGRLELGRLLPGRADIESMRRQPGRDLLAGMTV
AVVALPLALGFGVSSGLGAAAGLVTAIVAGALAAVFGGSNLQVSGPTGAMTVVLVPIVHR
HGPAGVLTVGLLAGMILLALAVLRVGRSVRYVPAPVVEGFTVGIAAVIFLQQVPSALGVH
ARNGDRVTGVAWAAVADFVHRPHWLALALAVGVAATMLVGARLRPTVPFSLLAVALATAL
VTAREWDVTTLGAIPATLPGPSLGFLDITAIPTLATAAVAVAALAALESLLSASVADGMT
VGQNHDPDRELFGQGLANLAVPLFGGVPATGAIARTAVNVRSGASSRLAALAHAVVLAGV
MLAAAPLVARIPLAALAGVLLATAVRMVEVSSLRTLGRASHSDALVMALTAGATLALDLV
IAVVLGLAVAGALALRAIARTARVEEVPLDPGDHHDSEHALLAEHIVAYRIDGPLFFAAA
HRFLLELTEVADVEILILRLSRVSAVDGTGALVLRDVIDRLEHRGVKVYVSGLRPEHAKA
VAAVGLVDRLRGQGRLFDSTPSAIQAARDHLHHTGALAAVPT
Download sequence
Identical sequences A0A062WQF0 Q2JFY0
106370.Francci3_0425 WP_011434890.1.5445 WP_011434890.1.57996 WP_011434890.1.64980 WP_011434890.1.9943 gi|86739141|ref|YP_479541.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]