SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 106370.Francci3_0441 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  106370.Francci3_0441
Domain Number 1 Region: 6-98
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.87e-21
Family Anti-sigma factor antagonist SpoIIaa 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 106370.Francci3_0441
Sequence length 115
Comment (Frankia CcI3)
Sequence
MRVEVTDRDAIVVHPAGDIDYSSLDPLREALLDARVAGVKEIIVDLEQVSFLDSQGLAVI
LFAHQRQRSAGGRLVLRNLNEDAYRLLHVTNLSAVIDVDHGDSAPARGLATRQGA
Download sequence
Identical sequences A0A062X1J5 Q2JFW5 W9DDR0
gi|86739156|ref|YP_479556.1| 106370.Francci3_0441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]