SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 110662.Syncc9605_2476 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  110662.Syncc9605_2476
Domain Number 1 Region: 145-420
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 9.2e-122
Family Enolase 0.0000000228
Further Details:      
 
Domain Number 2 Region: 8-142
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.95e-53
Family Enolase N-terminal domain-like 0.00000725
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 110662.Syncc9605_2476
Sequence length 430
Comment (Synechococcus CC9605)
Sequence
MIDSLDLVIDTIVAREVLDSRGNPTVEAEVLLEGGAMGRAIVPSGASTGAHEAHELRDGG
DRYMGKGVGQAVNHIEERIATALCGLSALDQAAVDAAMLELDGSDNKSNLGANAILAVSM
ATARAAANGLGIPLYRYLGGPMANLLPVPLMNVINGGAHAANSLDFQEFMLVPHGAPSFR
EALRMGTEVFHTLKKLLSDKGMSTAVGDEGGFAPDLGNVEAGEILVEAISKAGYKPGEQI
SLALDVASTEFFENGRYAFDGGSYTSAEMVGQLEQLVEKFPIVSIEDGLAEDDWDGWKLL
TERLGGKVQLVGDDLFVTNTKRLQQGIDSATANSILIKVNQIGSLTETLQAIDLAGRSGY
TSVISHRSGETEDTTIADLSVATRAGQIKTGSLSRSERVAKYNQLLRIEDELGSQAVYAG
AVGQGPRGKA
Download sequence
Identical sequences Q3AGS4
gi|78213984|ref|YP_382763.1| 110662.Syncc9605_2476 WP_011365403.1.53453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]