SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1140.Synpcc7942_0366 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1140.Synpcc7942_0366
Domain Number 1 Region: 607-715
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.76e-18
Family cAMP-binding domain 0.0064
Further Details:      
 
Domain Number 2 Region: 470-573
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000216
Family Anti-sigma factor antagonist SpoIIaa 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1140.Synpcc7942_0366
Sequence length 727
Comment (Synechococcus elongatus PCC 7942)
Sequence
MAWVGQRLIADLKSAPLRNILAGLVSGLLLLGENISAGLLIYSNVLSPYLASGLAALLIS
TACLNFFAVNRRGLPYGLATPDSRIYSLLAVIAAAISQSEALADTRMLGVTLLIYWVVAT
ACIGVALWLMGRCGIGEWLRYIPYPVVGGFLAATGWLLLTGGLNVALGFKISGATLERLW
SVDSAAKILVAVVFGLLLWQLGTRSKRVWITPVLLLAGLVGAQLVRVGLGYSLAEAAQFG
WFLPPLAPRIVFFWDWPRIPSIDWALLLPQIALIPVLILLAAISLTLNLSSLENVEKREL
DLNQELQRTGLANLIMLPFGGFSPGLLSGSRSTLNRLAGASTPLAAGVAAVLMLIAIALG
DLASWLCKPILAGLLVNIGLVYIDRWVFRSIRLLPQREYWVTIAILGISIVGGFLEAITA
GIVFSSLTFVVSYCRAPAIRSMATGAYLHSNIERVETQQSILRRRGAVLQVVSLQGYLFF
GTARRIVSTVRDRLQQSKVSINLVLLDYQAVTGADSSTAEVFSRFAVELQAQSIQLWVAA
IASDYQKPLRPFLQLLPEHQQFPDLNTALQAAEAKLLDQYARRPKSLPFALLLPELLALP
DDCDVPLQFWQRSQLKDGEVLYQQGDRADTIYWLERGELHLQATEAWDARQVLAGSPCGE
LAFLRGDTQPQTAIAVGRCMVYGLNRAALTELEASYPTVAIALYRWLLHRQSEQLQDQQL
RQHYLQA
Download sequence
Identical sequences A0A0H3K2Y1 Q31RC1
WP_011243459.1.45845 WP_011243459.1.5740 WP_011243459.1.95485 gi|81299177|ref|YP_399385.1| gi|56751156|ref|YP_171857.1| 1140.Synpcc7942_0366 269084.syc1147_c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]